PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009783717.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 509aa    MW: 56632.5 Da    PI: 6.4715
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009783717.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK60.33.6e-19315360348
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                       i+le+l+++F ++++dAA++Lgv  T+LKriCR y I RWP+ k
  XP_009783717.1 315 YGITLEVLKQHFGKKLTDAANSLGVARTTLKRICRDYEIYRWPRVK 360
                     579****************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.526298387IPR003035RWP-RK domain
PfamPF020426.6E-17317362IPR003035RWP-RK domain
SuperFamilySSF542774.25E-17410496No hitNo description
Gene3DG3DSA:3.10.20.2401.7E-15417496No hitNo description
SMARTSM006667.2E-14418499IPR000270PB1 domain
PROSITE profilePS5174516.006418499IPR000270PB1 domain
PfamPF005643.7E-14419497IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MANPNNVELE AAKLLHKLIQ ESKDEPTKLA TKLYEILRHM RSHGKGNSIP FKVVARAVET  60
LVKQHSLDIE ALASSHLPMT VGAQVGEVAT SQVAGSLQRV EVTRDMTVNF LGNENTTVNF  120
LGNEMVKADV YASNSAVSGS SGSGHGIYRV SGTHISGHPR SATEATQDKG DAMQPGILFD  180
MFNSFEIGQY QPAAVATLDN GDTMQFDAFF DMQDFFEFGQ PLSATKDKGD ANLVDSNQTT  240
TTSIADNRRH SPNLDDDVAR SLPGLELGIG TQIVQLGSEH HQVDDVEVDA RDLQRNVVHA  300
DLEKQNKTKR IKREYGITLE VLKQHFGKKL TDAANSLGVA RTTLKRICRD YEIYRWPRVK  360
SRKHNCSLSQ AELLQVVDRQ PSDSGPRHQQ YVDFSPGSGP KSATNSKELH VTMQSENFIS  420
VKVTYGNRTV RFPLSFSSGK RDLEEEVEKR IKLVGNSSIR YEDEEKDFIL ITCDSDLHYA  480
MHTLRSLGRT IIKMLVEIEP DYNHIIDSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009783716.10.0PREDICTED: uncharacterized protein LOC104232264 isoform X1
RefseqXP_016440590.10.0PREDICTED: uncharacterized protein LOC107766340 isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.12e-15Nin-like family protein